-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Fbx32/FBXO32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Fbx32/FBOX32 (Q969P5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Fbx32/FBXO32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Fbx32/FBOX32 (Q969P5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16037A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Fbx32/FBXO32 |
| Target Synonyms | Fbx32; MAFbx; Fbx32/FBOX32 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Fbx32/FBOX32 (Q969P5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN | Uniprot ID | Q969P5 |
Uniprot Id
Q969P5
Target Species
Human
Target Name
FBXO32
Target Full Name
F-box only protein 32
Target Function
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.
Target Involvement
Defects in FBXO32 are associated with susceptibility to dilated cardiomyopathy (DCM). A disorder characterized by ventricular and impaired systolic function, resulting in heart failure and arrhythmia. Patient are at risk of premature death.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Shuttles between cytoplasm and the nucleus.
Target Tissue Specificity
Specifically expressed in cardiac and skeletal muscle.
Target Synonyms
4833442G10Rik; AI430017; Atrogin 1; Atrogin-1; ATROGIN1; Atrophy gene 1; F box only protein 32; F-box only protein 32; F-box protein 32; FBX32_HUMAN; fbxo25; FBXO32; FLJ32424; MAFbx; MGC108443; MGC137646; MGC33610; Muscle atrophy F box; Muscle atrophy F box protein; Muscle atrophy F-box protein
Target Background
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification