Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FECH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human FECH (NP_000131.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FECH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human FECH (NP_000131.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01386A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FECH |
| Target Synonyms | EPP; FCE; EPP1; FECH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, HT-29, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human FECH (NP_000131.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTG | Uniprot ID | P22830 |
Uniprot Id
P22830
Target Species
Human
Target Name
FECH
Target Full Name
Ferrochelatase, mitochondrial
Target Function
Catalyzes the ferrous insertion into protoporphyrin IX.
Target Involvement
Erythropoietic protoporphyria (EPP)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Ferrochelatase family
Target Research Area
Cardiovascular
Target Synonyms
EPP; FCE; Fch; Fcl; fech; Ferrochelatase (protoporphyria); Ferrochelatase; Ferrochelatase mitochondrial; Heme synthase; Heme synthetase; HEMH_HUMAN; mitochondrial; Protoheme ferro lyase; Protoheme ferro-lyase; Protoporphyria
Target Background
The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
