-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FEZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human FEZ1 (NP_005094.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FEZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human FEZ1 (NP_005094.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10103A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FEZ1 |
| Target Synonyms | UNC-76; FEZ1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human FEZ1 (NP_005094.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEP | Uniprot ID | Q99689 |
Uniprot Id
Q99689
Target Species
Human
Target Name
FEZ1
Target Full Name
Fasciculation and elongation protein zeta-1
Target Function
May be involved in axonal outgrowth as component of the network of molecules that regulate cellular morphology and axon guidance machinery. Able to restore partial locomotion and axonal fasciculation to C.elegans unc-76 mutants in germline transformation experiments. May participate in the transport of mitochondria and other cargos along microtubules.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell membrane.
Target Protein Families
Zygin family
Target Tissue Specificity
Mainly expressed in brain.
Target Synonyms
FEZ1Fasciculation and elongation protein zeta-1; Zygin I; Zygin-1
Target Background
This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fasciculation, suggesting that it also functions in axonal outgrowth. The N-terminal half of the gene product is highly acidic. Alternatively spliced transcript variants encoding different isoforms of this protein have been described.
Notification