Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGF21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-209 of human FGF21 (NP_061986.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FGF21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-209 of human FGF21 (NP_061986.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-17013A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Fgf21 |
| Target Synonyms | FGF21; fibroblast growth factor 21 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse thymus, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-209 of human FGF21 (NP_061986.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS | Uniprot ID | Q9NSA1 |
Uniprot Id
Q9NSA1
Target Species
Human
Target Name
FGF21
Target Full Name
Fibroblast growth factor 21
Target Function
Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. Regulates systemic glucose homeostasis and insulin sensitivity.
Target Subcellular Location
Secreted.
Target Protein Families
Heparin-binding growth factors family
Target Research Area
Signal Transduction
Target Synonyms
FGF 21; FGF-21; Fgf21; FGF21_HUMAN; FGFL; Fibroblast growth factor 21; PRO10196; UNQ3115
Target Background
Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The encoded protein stimulates the uptake of glucose in adipose tissue.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
