-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FHL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 162-284 of human FHL5 (NP_065228.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against FHL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 162-284 of human FHL5 (NP_065228.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-15697A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FHL5 |
| Target Synonyms | ACT; FHL-5; dJ393D12.2; 1700027G07Rik; FHL5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with FHL5 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 162-284 of human FHL5 (NP_065228.4) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI | Uniprot ID | Q5TD97 |
Uniprot Id
Q5TD97
Target Species
Human
Target Name
FHL5
Target Full Name
Four and a half LIM domains protein 5
Target Function
May be involved in the regulation of spermatogenesis. Stimulates CREM transcriptional activity in a phosphorylation-independent manner.
Target Subcellular Location
Nucleus. Note=Nuclei of round and elongated spermatids.
Target Tissue Specificity
Testis-specific (at protein level).
Target Synonyms
Activator of cAMP responsive element modulator (CREM) in testis; Activator of cAMP-responsive element modulator in testis; Activator of CREM in testis; FHL-5; Fhl5; FHL5 protein; FHL5_HUMAN; Four and a half LIM domains protein 5
Target Background
The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. Polymorphisms in this gene may be associated with susceptibility for migraine headaches. Alternative splicing results in multiple transcript variants encoding the same protein.
Notification