-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Fibrillarin/U3 RNP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 222-321 of human Fibrillarin/U3 RNP (P22087) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against Fibrillarin/U3 RNP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 222-321 of human Fibrillarin/U3 RNP (P22087) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-17049A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Fibrillarin/U3 RNP |
| Target Synonyms | FIB; FLRN; Nop1; RNU3IP1; Fibrillarin/U3 RNP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Hep G2, Jurkat, Mouse spleen, Rat liver | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 222-321 of human Fibrillarin/U3 RNP (P22087). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN | Uniprot ID | P22087 |
Uniprot Id
P22087
Target Species
Human
Target Name
FBL
Target Full Name
rRNA 2'-O-methyltransferase fibrillarin
Target Function
S-adenosyl-L-methionine-dependent methyltransferase that has the ability to methylate both RNAs and proteins. Involved in pre-rRNA processing by catalyzing the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA. Probably catalyzes 2'-O-methylation of U6 snRNAs in box C/D RNP complexes. U6 snRNA 2'-O-methylation is required for mRNA splicing fidelity. Also acts as a protein methyltransferase by mediating methylation of 'Gln-105' of histone H2A (H2AQ104me), a modification that impairs binding of the FACT complex and is specifically present at 35S ribosomal DNA locus.
Target Subcellular Location
Nucleus, nucleolus. Nucleus, nucleoplasm. Note=Fibrillar region of the nucleolus.
Target Protein Families
Methyltransferase superfamily, Fibrillarin family
Target Synonyms
FIB; FLRN; Nop1; RNU3IP1; Fibrillarin/U3 RNP
Target Background
This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
Notification