Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FLVCR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human FLVCR1 (NP_054772.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FLVCR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human FLVCR1 (NP_054772.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10136A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FLVCR1 |
| Target Synonyms | PCA; AXPC1; FLVCR; PCARP; MFSD7B; SLC49A1; FLVCR1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human FLVCR1 (NP_054772.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVGFLLPPVLVPNTQNDTNLLACNISTMFYGTSAVATLLFILTAIAFKEKPRYPPSQAQAALQDSPPEEYSYKKSIRNLFKNIPFVLLLITYGIMTGAFYS | Uniprot ID | Q9Y5Y0 |
Uniprot Id
Q9Y5Y0
Target Species
Human
Target Name
FLVCR1
Target Full Name
Choline/ethanolamine transporter FLVCR1
Target Function
Heme transporter that exports cytoplasmic heme. It can also export coproporphyrin and protoporphyrin IX, which are both intermediate products in the heme biosynthetic pathway. Does not export bilirubin. Heme export depends on the presence of HPX and is required to maintain intracellular free heme balance, protecting cells from heme toxicity. Heme export provides protection from heme or ferrous iron toxicities in liver, brain, sensory neurons and during erythtopoiesis, a process in which heme synthesis intensifies. Causes susceptibility to FeLV-C in vitro.; Heme transporter that promotes heme efflux from the mitochondrion to the cytoplasm. Essential for erythroid differentiation
Target Involvement
Posterior column ataxia with retinitis pigmentosa (PCARP)
Target Subcellular Location
[Isoform 1]: Cell membrane; Multi-pass membrane protein.; [Isoform 2]: Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Feline leukemia virus subgroup C receptor (TC 2.A.1.28.1) family
Target Tissue Specificity
Found all hematopoietic tissues including peripheral blood lymphocytes. Some expression is found in pancreas and kidney.
Target Synonyms
Feline leukemia virus subgroup C cellular receptor; Feline leukemia virus subgroup C receptor; Feline leukemia virus subgroup C receptor related protein 1; Feline leukemia virus subgroup C receptor-related protein 1; FLVC1_HUMAN; FLVCR 1; FLVCR protein; FLVCR1; hFLVCR
Target Background
This gene encodes a member of the major facilitator superfamily of transporter proteins. The encoded protein is a heme transporter that may play a critical role in erythropoiesis by protecting developing erythroid cells from heme toxicity. This gene may play a role in posterior column ataxia with retinitis pigmentosa and the hematological disorder Diamond-Blackfan syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
