-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FLVCR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLVCR2 (NP_060261.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FLVCR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLVCR2 (NP_060261.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01928A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FLVCR2 |
| Target Synonyms | CCT; EPV; PVHH; MFSD7C; SLC49A2; C14orf58; FLVCRL14q; FLVCR2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, MCF7, Mouse brain, Mouse liver, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLVCR2 (NP_060261.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSF | Uniprot ID | Q9UPI3 |
Uniprot Id
Q9UPI3
Target Species
Human
Target Name
FLVCR2
Target Full Name
Choline/ethanolamine transporter FLVCR2
Target Function
Acts as an importer of heme. Also acts as a transporter for a calcium-chelator complex, important for growth and calcium metabolism.
Target Involvement
Proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome (PVHH)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Feline leukemia virus subgroup C receptor (TC 2.A.1.28.1) family
Target Tissue Specificity
Expressed in non-hematopoietic tissues, with relative abundant expression in brain, placenta, lung, liver and kidney. Also expressed in hematopoietic tissues (fetal liver, spleen, lymph node, thymus, leukocytes and bone marrow). Found in acidophil cells o
Target Synonyms
FLVCR2; C14orf58Feline leukemia virus subgroup C receptor-related protein 2; Calcium-chelate transporter; CCT
Target Background
This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.
Notification