Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOPNL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human FOPNL (NP_653201.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOPNL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human FOPNL (NP_653201.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07117A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOPNL |
| Target Synonyms | FOPNL; FOR20; C16orf63; PHSECRG2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-100 of human FOPNL (NP_653201.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESK | Uniprot ID | Q96NB1 |
Uniprot Id
Q96NB1
Target Species
Human
Target Name
CEP20
Target Full Name
Centrosomal protein 20
Target Function
Involved in the biogenesis of cilia. Required for the recruitment of PLK1 to centrosomes and S phase progression.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cell projection, cilium. Cytoplasm, cytoskeleton, cilium basal body. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasmic granule. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite.
Target Protein Families
FGFR1OP family
Target Tissue Specificity
Widely expressed. Detected in brain, heart, kidney, liver, lung, skeletal muscle, placenta and intestine.
Target Synonyms
FOPNL; C16orf63; FOR20; PHSECRG2LisH domain-containing protein FOPNL; FGFR1OP N-terminal-like protein; FOP-related protein of 20 kDa
Target Background
Enables identical protein binding activity. Involved in cilium assembly. Located in centriolar satellite and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
