Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXD1 (NP_004463.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOXD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXD1 (NP_004463.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10603A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXD1 |
| Target Synonyms | FKHL8; FREAC4; FREAC-4; FOXD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BxPC-3, Mouse eye, mouse fetal, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXD1 (NP_004463.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPPGPAPAAGAGA | Uniprot ID | Q16676 |
Uniprot Id
Q16676
Target Species
Human
Target Name
FOXD1
Target Full Name
Forkhead box protein D1
Target Function
Transcription factor involved in regulation of gene expression in a variety of processes, including formation of positional identity in the developing retina, regionalization of the optic chiasm, morphogenesis of the kidney, and neuralization of ectodermal cells. Involved in transcriptional activation of PGF and C3 genes.
Target Subcellular Location
Nucleus.
Target Synonyms
Brain Factor 2; FKH L8; FKHL 8; FKHL8; Forkhead (Drosophila) like 8; Forkhead box D1; Forkhead box protein D1; Forkhead drosophila homolog like 8; Forkhead like 8; Forkhead related activator 4; Forkhead related protein FKHL8; Forkhead related transcription factor 4; Forkhead-related protein FKHL8; Forkhead-related transcription factor 4; FOX D1; FOXD 1; foxd1; FOXD1_HUMAN; FREAC 4; FREAC-4; FREAC4
Target Background
This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. Studies of the orthologous mouse protein indicate that it functions in kidney development by promoting nephron progenitor differentiation, and it also functions in the development of the retina and optic chiasm. It may also regulate inflammatory reactions and prevent autoimmunity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
