-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXL2 (P58012) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOXL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXL2 (P58012) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14154A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXL2 |
| Target Synonyms | BPES; PFRK; POF3; BPES1; PINTO; FOXL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse testis, Rat ovary, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXL2 (P58012). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQN | Uniprot ID | P58012 |
Uniprot Id
P58012
Target Species
Human
Target Name
FOXL2
Target Full Name
Forkhead box protein L2
Target Function
Transcriptional regulator. Critical factor essential for ovary differentiation and maintenance, and repression of the genetic program for somatic testis determination. Prevents trans-differentiation of ovary to testis through transcriptional repression of the Sertoli cell-promoting gene SOX9. Has apoptotic activity in ovarian cells. Suppresses ESR1-mediated transcription of PTGS2/COX2 stimulated by tamoxifen. Is a regulator of CYP19 expression. Participates in SMAD3-dependent transcription of FST via the intronic SMAD-binding element. Is a transcriptional repressor of STAR. Activates SIRT1 transcription under cellular stress conditions. Activates transcription of OSR2.
Target Involvement
Blepharophimosis, ptosis, and epicanthus inversus syndrome (BPES); Premature ovarian failure 3 (POF3)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
In addition to its expression in the developing eyelid, it is transcribed very early in somatic cells of the developing gonad (before sex determination) and its expression persists in the follicular cells of the adult ovary.
Target Research Area
Others
Target Synonyms
Blepharophimosis; Blepharophimosis epicanthus inversus and ptosis 1; Blepharophimosis epicanthus inversus and ptosis; BPES 1; BPES; BPES1; Epicanthus inversus and ptosis 1; Forkhead box L2; Forkhead box protein L2; Forkhead transcription factor FOXL2; FOX L2; FOXL 2; FOXL2; FOXL2_HUMAN; PFRK; PINTO; PITUITARY FORKHEAD FACTOR; POF 3; POF3
Target Background
This gene encodes a forkhead transcription factor. The protein contains a fork-head DNA-binding domain and may play a role in ovarian development and function. Expansion of a polyalanine repeat region and other mutations in this gene are a cause of blepharophimosis syndrome and premature ovarian failure 3.
Notification