Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FUT8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-575 of human FUT8 (NP_835367.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FUT8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 376-575 of human FUT8 (NP_835367.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03341A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FUT8 |
| Target Synonyms | CDGF; CDGF1; FUT8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 376-575 of human FUT8 (NP_835367.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK | Uniprot ID | Q9BYC5 |
Uniprot Id
Q9BYC5
Target Species
Human
Target Name
FUT8
Target Full Name
Alpha-(1,6)-fucosyltransferase
Target Function
Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 23 family
Target Synonyms
6-fucosyltransferase; Alpha (1,6) fucosyltransferase; Alpha-(1,6)-fucosyltransferase; Alpha1 6FucT; alpha1-6FucT; Fucosyltransferase 8 (alpha (1,6) fucosyltransferase) ; Fucosyltransferase 8; FUT8; FUT8_HUMAN; GDP fucose glycoprotein fucosyltransferase; GDP L Fuc:N acetyl beta D glucosaminide alpha1,6 fucosyltransferase; GDP-fucose--glycoprotein fucosyltransferase; GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1; Glycoprotein 6 alpha L fucosyltransferase; Glycoprotein 6-alpha-L-fucosyltransferase; MGC26465
Target Background
This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
