Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABARAPL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human GABARAPL1 (NP_113600.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABARAPL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human GABARAPL1 (NP_113600.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01941A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABARAPL1 |
| Target Synonyms | ATG8; GEC1; APG8L; ATG8B; ATG8L; APG8-LIKE; GABARAPL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human GABARAPL1 (NP_113600.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL | Uniprot ID | Q9H0R8 |
Uniprot Id
Q9H0R8
Target Species
Human
Target Name
GABARAPL1
Target Full Name
Gamma-aminobutyric acid receptor-associated protein-like 1
Target Function
Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.
Target Subcellular Location
Cytoplasmic vesicle, autophagosome. Cytoplasmic vesicle membrane; Lipid-anchor. Cytoplasm, cytoskeleton. Endoplasmic reticulum. Golgi apparatus.
Target Protein Families
ATG8 family
Target Tissue Specificity
Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motone
Target Research Area
Neuroscience
Target Synonyms
APG8 like; APG8L; ATG8; ATG8B; ATG8L; Early estrogen regulated protein; Early estrogen-regulated protein; GABA; GABA(A) receptor associated protein like 1; GABA(A) receptor-associated protein-like 1; GABARAPL1 a; GABARAPL1; Gamma aminobutyric acid receptor associated protein like 1; Gamma-aminobutyric acid receptor-associated protein-like 1; GBRL1_HUMAN; GEC 1; GEC-1; GEC1; Glandular epithelial cell protein 1
Target Background
Enables Tat protein binding activity and ubiquitin protein ligase binding activity. Predicted to be involved in autophagosome assembly; autophagy of mitochondrion; and cellular response to nitrogen starvation. Located in autophagosome. Colocalizes with mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
