-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABRB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 330-460 of human GABRB3 (NP_000805.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABRB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 330-460 of human GABRB3 (NP_000805.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11707A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABRB3 |
| Target Synonyms | ECA5; DEE43; EIEE43; GABRB3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, BT-474, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 330-460 of human GABRB3 (NP_000805.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTF | Uniprot ID | P28472 |
Uniprot Id
P28472
Target Species
Human
Target Name
GABRB3
Target Full Name
Gamma-aminobutyric acid receptor subunit beta-3
Target Function
Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain. Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer. The alpha1/beta3/gamma2 receptor exhibits synaptogenic activity. The alpha2/beta3/gamma2 receptor shows very little or no synaptogenic activity. Functions also as histamine receptor and mediates cellular responses to histamine. Plays an important role in somatosensation and in the production of antinociception.
Target Involvement
Epilepsy, childhood absence 5 (ECA5); Epileptic encephalopathy, early infantile, 43 (EIEE43)
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRB3 sub-subfamily
Target Synonyms
ECA5; GABA alpha receptor beta-2 subunit; GABA(A) receptor subunit beta-3; GABAA receptor beta 3 subunit; GABAA receptor subunit beta 3; GABR B3; Gabrb3; Gamma aminobutyric acid (GABA) A receptor beta 3; Gamma aminobutyric acid receptor subunit beta 3; Gamma-aminobutyric acid receptor subunit beta-3; GBRB3_HUMAN; MGC9051
Target Background
This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one the subunits of a multi-subunit chloride channel that serves as the receptor for gamma-aminobutyric acid, a major inhibitory neurotransmitter of the mammalian nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two other genes encoding related subunits of the family. This gene may be associated with the pathogenesis of several disorders including Angelman syndrome, Prader-Willi syndrome, nonsyndromic orofacial clefts, epilepsy and autism. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Notification