Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GALNT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 442-571 of human GALNT2 (NP_004472.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GALNT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 442-571 of human GALNT2 (NP_004472.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09411A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GALNT2 |
| Target Synonyms | CDG2T; GalNAc-T2; GALNT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Jurkat, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 442-571 of human GALNT2 (NP_004472.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ | Uniprot ID | Q10471 |
Uniprot Id
Q10471
Target Species
Human
Target Name
GALNT2
Target Full Name
Polypeptide N-acetylgalactosaminyltransferase 2
Target Function
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b. Probably involved in O-linked glycosylation of the immunoglobulin A1 (IgA1) hinge region. Involved in O-linked glycosylation of APOC-III, ANGPTL3 and PLTP. It participates in the regulation of HDL-C metabolism.
Target Subcellular Location
Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Resides preferentially in the trans and medial parts of the Golgi stack. A secreted form also exists.
Target Protein Families
Glycosyltransferase 2 family, GalNAc-T subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
GalNAc T2; GalNAc-T2; Galnt2; GALT2_HUMAN; GaNTase 2; Polypeptide GalNAc transferase 2; Polypeptide N acetylgalactosaminyltransferase 2; Polypeptide N acetylgalactosaminyltransferase 2 soluble form; Polypeptide N-acetylgalactosaminyltransferase 2 soluble form; pp GaNTase 2; pp-GaNTase 2; Protein UDP acetylgalactosaminyltransferase 2; Protein-UDP acetylgalactosaminyltransferase 2; UDP GalNAc transferase 2; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 2 (GalNAc T2); UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 2; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2
Target Background
This gene encodes a member of the glycosyltransferase 2 protein family. Members of this family initiate mucin-type O-glycoslation of peptides in the Golgi apparatus. The encoded protein may be involved in O-linked glycosylation of the immunoglobulin A1 hinge region. This gene may influence triglyceride levels, and may be involved Type 2 diabetes, as well as several types of cancer. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
