-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GALNT7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human GALNT7 (NP_059119.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GALNT7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human GALNT7 (NP_059119.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07427A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GALNT7 |
| Target Synonyms | GalNAcT7; GALNAC-T7; GALNT7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human GALNT7 (NP_059119.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPG | Uniprot ID | Q86SF2 |
Uniprot Id
Q86SF2
Target Species
Human
Target Name
GALNT7
Target Full Name
N-acetylgalactosaminyltransferase 7
Target Function
Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 2 family, GalNAc-T subfamily
Target Tissue Specificity
Widely expressed. Expressed in uterus, retina, kidney, small intestine, omentum, stomach and CNS.
Target Synonyms
GalNAc T7; GalNAc-T7; GalNAcT7; GALNT 7; Galnt7; GALT7_HUMAN; N acetylgalactosaminyltransferase 7; N-acetylgalactosaminyltransferase 7; Polypeptide GalNAc transferase 7; Polypeptide N acetylgalactosaminyltransferase 7; pp GaNTase 7; pp-GaNTase 7; Protein UDP acetylgalactosaminyltransferase 7; Protein-UDP acetylgalactosaminyltransferase 7; UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 7; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 7; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7
Target Background
This gene encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation.
Notification