-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GDF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 251-364 of human GDF3 (NP_065685.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GDF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 251-364 of human GDF3 (NP_065685.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00504A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GDF3 |
| Target Synonyms | KFS3; MCOP7; MCOPCB6; GDF3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 251-364 of human GDF3 (NP_065685.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG | Uniprot ID | Q9NR23 |
Uniprot Id
Q9NR23
Target Species
Human
Target Name
GDF3
Target Full Name
Growth/differentiation factor 3
Target Function
Growth factor involved in early embryonic development and adipose-tissue homeostasis. During embryogenesis controls formation of anterior visceral endoderm and mesoderm and the establishment of anterior-posterior identity through a receptor complex comprising the receptor ACVR1B and the coreceptor TDGF1/Cripto. Regulates adipose-tissue homeostasis and energy balance under nutrient overload in part by signaling through the receptor complex based on ACVR1C and TDGF1/Cripto.
Target Involvement
Klippel-Feil syndrome 3, autosomal dominant (KFS3); Microphthalmia, isolated, with coloboma, 6 (MCOPCB6); Microphthalmia, isolated, 7 (MCOP7)
Target Subcellular Location
Secreted. Cytoplasm.
Target Protein Families
TGF-beta family
Target Synonyms
C78318; ecat9; GDF 3 ; GDF-3; GDF3; GDF3_HUMAN; Growth differentiation factor 3; Growth/differentiation factor 3; KFS3; MCOP7; MCOPCB6; MGC123990; MGC123991; RGD1564178; Vgr 2; Vgr2
Target Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role ocular and skeletal development. Mutations in this gene are associated with microphthalmia, coloboma, and skeletal abnormalities in human patients.
Notification