-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GFI1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GFI1B (NP_001128503.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GFI1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GFI1B (NP_001128503.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08738A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GFI1B |
| Target Synonyms | BDPLT17; ZNF163B; GFI1B | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GFI1B (NP_001128503.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPNQCLDWTNLKREPELEQDQNLARMAPAPEGPIVLSRPQDGDSPLSDSPPFYKPSFSWDTLATTYGHSYRQAPSTMQSAFLEHSVSLYGSPLVPSTEPAL | Uniprot ID | Q5VTD9 |
Uniprot Id
Q5VTD9
Target Species
Human
Target Name
GFI1B
Target Full Name
Zinc finger protein Gfi-1b
Target Function
Essential proto-oncogenic transcriptional regulator necessary for development and differentiation of erythroid and megakaryocytic lineages. Component of a RCOR-GFI-KDM1A-HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation. Transcriptional repressor or activator depending on both promoter and cell type context; represses promoter activity of SOCS1 and SOCS3 and thus, may regulate cytokine signaling pathways. Cooperates with GATA1 to repress target gene transcription, such as the apoptosis regulator BCL2L1; GFI1B silencing in leukemic cell lines markedly increase apoptosis rate. Inhibits down-regulation of MYC and MYB as well as the cyclin-dependent kinase inhibitor CDKN1A/P21WAF1 in IL6-treated myelomonocytic cells. Represses expression of GATA3 in T-cell lymphomas and inhibits GATA1-mediated transcription; as GATA1 also mediates erythroid GFI1B transcription, both GATA1 and GFI1B participate in a feedback regulatory pathway controlling the expression of GFI1B gene in erythroid cells. Suppresses GATA1-mediated stimulation of GFI1B promoter through protein interaction. Binds to gamma-satellite DNA and to its own promoter, auto-repressing its own expression. Alters histone methylation by recruiting histone methyltransferase to target genes promoters. Plays a role in heterochromatin formation.
Target Involvement
Bleeding disorder, platelet-type 17 (BDPLT17)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in bone marrow and fetal liver, but also detectable in fetal spleen, fetal thymus, and testes. Detected in hematopoietic stem cells, erythroblasts, and megakaryocytes. Overexpressed in bone marrow of patients with erythroleukemia and megakaryocy
Target Synonyms
GFI 1B; gfi1b; GFI1B protein; GFI1B_HUMAN; Growth factor independent 1B protein; Growth factor independent 1B transcription repressor; Growth factor independent protein 1B; OTTHUMP00000022443; OTTHUMP00000022444; OTTHUMP000000235527; Potential regulator of CDKN1A; Potential regulator of CDKN1A translocated in CML; Translocated in CML; Zinc finger protein Gfi-1b
Target Background
This gene encodes a zinc-finger containing transcriptional regulator that is primarily expressed in cells of hematopoietic lineage. The encoded protein complexes with numerous other transcriptional regulatory proteins including GATA-1, runt-related transcription factor 1 and histone deacetylases to control expression of genes involved in the development and maturation of erythrocytes and megakaryocytes. Mutations in this gene are the cause of the autosomal dominant platelet disorder, platelet-type bleeding disorder-17. Alternate splicing results in multiple transcript variants.
Notification