-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GFRA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-420 of human GFRA1 (NP_005255.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GFRA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-420 of human GFRA1 (NP_005255.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12401A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GFRA1 |
| Target Synonyms | GDNFR; RET1L; RETL1; RHDA4; TRNR1; GDNFRA; GFRalpha-1; GFR-ALPHA-1; GDNFR-alpha-1; GFRA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, MCF7, Mouse brain, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 345-420 of human GFRA1 (NP_005255.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGNGSDVTVWQPAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNY | Uniprot ID | P56159 |
Uniprot Id
P56159
Target Species
Human
Target Name
GFRA1
Target Full Name
GDNF family receptor alpha-1
Target Function
Receptor for GDNF. Mediates the GDNF-induced autophosphorylation and activation of the RET receptor.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Golgi apparatus, trans-Golgi network. Endosome. Endosome, multivesicular body.
Target Protein Families
GDNFR family
Target Synonyms
GDNF family receptor alpha 1; GDNF family receptor alpha-1; GDNF R; GDNF RA; GDNF receptor alpha; GDNF receptor alpha-1; GDNFR alpha 1; GDNFR alpha; GDNFR; GDNFR-alpha-1; GDNFRA; GDNFRalpha; GFR alpha 1; GFR alpha1; GFR-alpha-1; GFRA 1; Gfra1; GFRA1_HUMAN; GFRalpha1; Glial cell line derived neurotrophic factor receptor alpha; GPI linked anchor protein; MGC23045; PI linked cell surface accessory protein; RET 1L; RET ligand 1; RET1L; RETL 1; RETL1; TGF beta related neurotrophic factor receptor 1; TGF-beta-related neurotrophic factor receptor 1; TRNR 1; TRNR1
Target Background
This gene encodes a member of the glial cell line-derived neurotrophic factor receptor (GDNFR) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature receptor. Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. This receptor is a glycosylphosphatidylinositol (GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
Notification