-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GH1 (NP_000506.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GH1 (NP_000506.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-06823A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GH1 |
| Target Synonyms | GH; GHN; GH-N; GHB5; IGHD2; hGH-N; IGHD1A; IGHD1B; GH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GH1 (NP_000506.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVE | Uniprot ID | P01241 |
Uniprot Id
P01241
Target Species
Human
Target Name
GH1
Target Full Name
Somatotropin
Target Function
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Target Involvement
Growth hormone deficiency, isolated, 1A (IGHD1A); Growth hormone deficiency, isolated, 1B (IGHD1B); Kowarski syndrome (KWKS); Growth hormone deficiency, isolated, 2 (IGHD2)
Target Subcellular Location
Secreted.
Target Protein Families
Somatotropin/prolactin family
Target Research Area
Developmental Biology
Target Synonyms
gH; GH-N; GH1; GHB5; GHN; Growth hormone 1; Growth hormone; Growth hormone B5; Growth hormone; normal; Growth hormone; pituitary; HG1; hGH-N; IGHD1B; Pituitary growth hormone; RNGHGP; SOMA_HUMAN; Somatotropin
Target Background
The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Notification