-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GHRL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GHRL (NP_057446.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GHRL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GHRL (NP_057446.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10328A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GHRL |
| Target Synonyms | MTLRP; GHRL | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GHRL (NP_057446.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK | Uniprot ID | Q9UBU3 |
Uniprot Id
Q9UBU3
Target Species
Human
Target Name
GHRL
Target Full Name
Appetite-regulating hormone
Target Function
Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.; Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility.
Target Subcellular Location
Secreted.
Target Protein Families
Motilin family
Target Tissue Specificity
Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.
Target Research Area
Cardiovascular
Target Synonyms
Appetite regulating hormone; Ghrelin 27; Ghrelin 28; Ghrelin and obestatin prepropeptide; Ghrelin; Ghrelin/obestatin prepropeptide ; ghrl; GHRL_HUMAN; Growth hormone releasing peptide; Growth hormone secretagogue; Growth hormone-releasing peptide; M46 protein; Motilin related peptide; Motilin-related peptide; MTLRP ; Obestatin; Protein M46
Target Background
This gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides, ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty, whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities, including hunger, reward perception via the mesolimbic pathway, gastric acid secretion, gastrointestinal motility, and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake, but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin, including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition, antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression.
Notification