-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLIPR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-140 of human GLIPR1 (NP_006842.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GLIPR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-140 of human GLIPR1 (NP_006842.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00259A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLIPR1 |
| Target Synonyms | GLIPR; RTVP1; CRISP7; GLIPR1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-140 of human GLIPR1 (NP_006842.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQ | Uniprot ID | P48060 |
Uniprot Id
P48060
Target Species
Human
Target Name
GLIPR1
Target Full Name
Glioma pathogenesis-related protein 1
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Protein Families
CRISP family
Target Tissue Specificity
According to PubMed:8973356, it is ubiquitously expressed with high levels in lung and kidney and low levels in heart and liver. Highly expressed in cell lines derived from nervous system tumors arising from glia, low or absent in non-glial-derived nervou
Target Research Area
Cancer
Target Synonyms
CRISP 7; CRISP7; GLI pathogenesis related 1; GLI pathogenesis-related 1 (glioma); Glioma pathogenesis related protein 1; Glioma pathogenesis-related protein 1; GLIP1_HUMAN; GliPR 1; GLIPR; GLIPR1; Protein RTVP-1; RELATED TO TESTIS SPECIFIC; VESPID; AND PATHOGENESIS PROTEINS 1; RTVP 1; RTVP1; Testes specific vespid and pathogenesis protein 1; testes-specific vespid and pathogenesis protein 1
Target Background
This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Notification