Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLIS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 606-775 of human GLIS3 (NP_689842.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GLIS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 606-775 of human GLIS3 (NP_689842.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09266A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLIS3 |
| Target Synonyms | NDH; ZNF515; GLIS3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 606-775 of human GLIS3 (NP_689842.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVPSFEDCLVPTSMGQASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSSVYTEG | Uniprot ID | Q8NEA6 |
Uniprot Id
Q8NEA6
Target Species
Human
Target Name
GLIS3
Target Full Name
Zinc finger protein GLIS3
Target Function
Acts as both a repressor and activator of transcription. Binds to the consensus sequence 5'-GACCACCCAC-3'.
Target Involvement
Diabetes mellitus, neonatal, with congenital hypothyroidism (NDH)
Target Subcellular Location
Nucleus.
Target Protein Families
GLI C2H2-type zinc-finger protein family
Target Tissue Specificity
In the adult, expressed at high levels in the kidney and at lower levels in the brain, skeletal muscle, pancreas, liver, lung, thymus and ovary.
Target Synonyms
GLIS3; ZNF515; Zinc finger protein GLIS3; GLI-similar 3; Zinc finger protein 515
Target Background
This gene is a member of the GLI-similar zinc finger protein family and encodes a nuclear protein with five C2H2-type zinc finger domains. This protein functions as both a repressor and activator of transcription and is specifically involved in the development of pancreatic beta cells, the thyroid, eye, liver and kidney. Mutations in this gene have been associated with neonatal diabetes and congenital hypothyroidism (NDH). Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only two have been determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
