Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLO1 (Q04760) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GLO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLO1 (Q04760) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13847A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLO1 |
| Target Synonyms | GLYI; GLOD1; HEL-S-74; GLO1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, HT-29, Mouse brain, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLO1 (Q04760). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLE | Uniprot ID | Q04760 |
Uniprot Id
Q04760
Target Species
Human
Target Name
GLO1
Target Full Name
Lactoylglutathione lyase
Target Function
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis.
Target Protein Families
Glyoxalase I family
Target Research Area
Signal Transduction
Target Synonyms
Aldoketomutase; glo1; GLOD1; Glx I; GLYI; glyoxalase domain containing 1; Glyoxalase I; Ketone aldehyde mutase ; Ketone-aldehyde mutase; Lactoyl glutathione lyase ; Lactoylglutathione lyase; LGUL_HUMAN; Methylglyoxalase; S D lactoylglutathione methylglyoxal lyase ; S-D-lactoylglutathione methylglyoxal lyase
Target Background
The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
