-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLUD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 459-558 of human GLUD1 (P00367) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GLUD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 459-558 of human GLUD1 (P00367) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16801A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLUD1 |
| Target Synonyms | GDH; GDH1; GLUD; hGDH1; GLUD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562, Mouse liver, Rat liver, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 459-558 of human GLUD1 (P00367). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT | Uniprot ID | P00367 |
Uniprot Id
P00367
Target Species
Human
Target Name
GLUD1
Target Full Name
Glutamate dehydrogenase 1, mitochondrial
Target Function
Mitochondrial glutamate dehydrogenase that catalyzes the conversion of L-glutamate into alpha-ketoglutarate. Plays a key role in glutamine anaplerosis by producing alpha-ketoglutarate, an important intermediate in the tricarboxylic acid cycle. Plays a role in insulin homeostasis. May be involved in learning and memory reactions by increasing the turnover of the excitatory neurotransmitter glutamate.
Target Involvement
Familial hyperinsulinemic hypoglycemia 6 (HHF6)
Target Subcellular Location
Mitochondrion. Endoplasmic reticulum.
Target Protein Families
Glu/Leu/Phe/Val dehydrogenases family
Target Synonyms
AI118167; DHE3_HUMAN; EC 1.4.1.3; GDH 1; GDH; Gdh-X; GDH1; GLUD; Glud1; Glud1a; Glud1b; Gludl; Glutamate dehydrogenase (NAD(P)+); Glutamate dehydrogenase 1; Glutamate dehydrogenase 1 mitochondrial; Glutamate dehydrogenase 1a; Glutamate dehydrogenase 1b; Memory-related gene 2 protein; MGC127177; MGC132003; MGC80801; MGC93608; mitochondrial; MRG-2
Target Background
This gene encodes glutamate dehydrogenase, which is a mitochondrial matrix enzyme that catalyzes the oxidative deamination of glutamate to alpha-ketoglutarate and ammonia. This enzyme has an important role in regulating amino acid-induced insulin secretion. It is allosterically activated by ADP and inhibited by GTP and ATP. Activating mutations in this gene are a common cause of congenital hyperinsulinism. Alternative splicing of this gene results in multiple transcript variants. The related glutamate dehydrogenase 2 gene on the human X-chromosome originated from this gene via retrotransposition and encodes a soluble form of glutamate dehydrogenase. Related pseudogenes have been identified on chromosomes 10, 18 and X.
Notification