Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-71 of human GNG2 (NP_444292.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-71 of human GNG2 (NP_444292.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01409A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNG2 |
| Target Synonyms | HG3F1; GNG2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-71 of human GNG2 (NP_444292.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL | Uniprot ID | P59768 |
Uniprot Id
P59768
Target Species
Human
Target Name
GNG2
Target Full Name
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
G protein gamma family
Target Tissue Specificity
Expressed in fetal tissues, including testis, adrenal gland, brain, white blood cells and brain.
Target Synonyms
G gamma I; G gamma-I; GBG2_HUMAN; GNG 2; Gng2; Guanine nucleotide binding protein gamma 2; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
Target Background
This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
