Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNRH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GNRH1 (NP_001076580.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GNRH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GNRH1 (NP_001076580.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10801A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNRH1 |
| Target Synonyms | GRH; GNRH; LHRH; LNRH; GNRH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GNRH1 (NP_001076580.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI | Uniprot ID | P01148 |
Uniprot Id
P01148
Target Species
Human
Target Name
GNRH1
Target Full Name
Progonadoliberin-1
Target Function
Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Target Involvement
Hypogonadotropic hypogonadism 12 with or without anosmia (HH12)
Target Subcellular Location
Secreted.
Target Protein Families
GnRH family
Target Synonyms
GNRH1; GNRH; GRH; LHRHProgonadoliberin-1; Progonadoliberin I) [Cleaved into: Gonadoliberin-1; Gonadoliberin I; Gonadorelin; Gonadotropin-releasing hormone I; GnRH-I; Luliberin I; Luteinizing hormone-releasing hormone I; LH-RH I); GnRH-associated peptide 1; GnRH-associated peptide I)]
Target Background
This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
