Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GOT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human GOT2 (NP_002071.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GOT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human GOT2 (NP_002071.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02794A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GOT2 |
| Target Synonyms | KAT4; DEE82; KATIV; KYAT4; mitAAT; GOT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, BT-474, HepG2, Jurkat, Mouse brain, Mouse liver, Rat kidney, SW620 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human GOT2 (NP_002071.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISK | Uniprot ID | P00505 |
Uniprot Id
P00505
Target Species
Human
Target Name
GOT2
Target Full Name
Aspartate aminotransferase, mitochondrial
Target Function
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). As a member of the malate-aspartate shuttle, it has a key role in the intracellular NAD(H) redox balance. Is important for metabolite exchange between mitochondria and cytosol, and for amino acid metabolism. Facilitates cellular uptake of long-chain free fatty acids.
Target Subcellular Location
Mitochondrion matrix. Cell membrane.
Target Protein Families
Class-I pyridoxal-phosphate-dependent aminotransferase family
Target Research Area
Cancer, Transport
Target Synonyms
AATM_HUMAN; AL022787; Aspartate aminotransferase 2; Aspartate aminotransferase; Aspartate aminotransferase; mitochondrial; Aspartate transaminase 2; ASPATA; EC 2.6.1.1; FABP 1; FABP pm; FABP-1; FABPpm; Fatty acid binding protein; Fatty acid-binding protein; FLJ40994; Glutamate oxaloacetate transaminase 2; Glutamate oxaloacetate transaminase 2; mitochondrial; Glutamate oxaloacetate transaminase; mitochondrial; Glutamic oxaloacetic transaminase 2; mitochondrial (aspartate aminotransferase 2); Got 2; GOT2; KAT4; KATIV; kynurenine aminotransferase 4; Kynurenine aminotransferase IV; kynurenine--oxoglutarate transaminase 4; kynurenine--oxoglutarate transaminase IV; mAspAT; MGC102129; MGC115763; mitAAT; mitochondrial; Mitochondrial aspartate aminotransferase; OTTMUSP00000017748; Plasma membrane fatty acid binding protein; Plasma membrane-associated fatty acid-binding protein; Transaminase A
Target Background
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
