Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR35 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GPR35 (NP_005292.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR35 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GPR35 (NP_005292.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10535A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR35 |
| Target Synonyms | GPR35 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse liver, Mouse stomach | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GPR35 (NP_005292.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVA | Uniprot ID | Q9HC97 |
Uniprot Id
Q9HC97
Target Species
Human
Target Name
GPR35
Target Full Name
G-protein coupled receptor 35
Target Function
Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Internalized to the cytoplasm after exposure to kynurenic acid.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Predominantly expressed in immune and gastrointestinal tissues.
Target Synonyms
GPR35; G-protein coupled receptor 35; Kynurenic acid receptor; KYNA receptor
Target Background
Enables C-X-C chemokine receptor activity. Involved in several processes, including chemokine-mediated signaling pathway; negative regulation of voltage-gated calcium channel activity; and positive regulation of cytosolic calcium ion concentration. Is integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
