Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR52 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-265 of human GPR52 (NP_005675.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR52 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-265 of human GPR52 (NP_005675.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02291A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR52 |
| Target Synonyms | GPR52 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Rat lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-265 of human GPR52 (NP_005675.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLYAPAAFVVCFTYFHIFKICRQHTKEINDRRARFPSHEVDSSRETGHSPDRRYAM | Uniprot ID | Q9Y2T5 |
Uniprot Id
Q9Y2T5
Target Species
Human
Target Name
GPR52
Target Full Name
G-protein coupled receptor 52
Target Function
Gs-coupled receptor activated by antipsychotics reserpine leading to an increase in intracellular cAMP and its internalization. May play a role in locomotor activity through modulation of dopamine, NMDA and ADORA2A-induced locomotor activity. These behavioral changes are accompanied by modulation of the dopamine receptor signaling pathway in striatum. Modulates HTT level via cAMP-dependent but PKA independent mechanisms throught activation of RAB39B that translocates HTT to the endoplasmic reticulum, thus avoiding proteasome degradation.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in brain, especially in striatum.
Target Synonyms
GPR52; G-protein coupled receptor 52
Target Background
Members of the G protein-coupled receptor (GPR) family play important roles in signal transduction from the external environment to the inside of the cell.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
