-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRB7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GRB7 (NP_001229372.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GRB7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GRB7 (NP_001229372.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03712A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRB7 |
| Target Synonyms | GRB7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GRB7 (NP_001229372.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD | Uniprot ID | Q14451 |
Uniprot Id
Q14451
Target Species
Human
Target Name
GRB7
Target Full Name
Growth factor receptor-bound protein 7
Target Function
Adapter protein that interacts with the cytoplasmic domain of numerous receptor kinases and modulates down-stream signaling. Promotes activation of down-stream protein kinases, including STAT3, AKT1, MAPK1 and/or MAPK3. Promotes activation of HRAS. Plays a role in signal transduction in response to EGF. Plays a role in the regulation of cell proliferation and cell migration. Plays a role in the assembly and stability of RNA stress granules. Binds to the 5'UTR of target mRNA molecules and represses translation of target mRNA species, when not phosphorylated. Phosphorylation impairs RNA binding and promotes stress granule disassembly during recovery after cellular stress.
Target Subcellular Location
Cytoplasm. Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic granule. Cell projection.
Target Protein Families
GRB7/10/14 family
Target Synonyms
B47; Epidermal growth factor receptor GRB 7; Epidermal growth factor receptor GRB-7; GRB7 adapter protein; GRB7; GRB7_HUMAN; Growth factor receptor bound protein 7; Growth factor receptor-bound protein 7; OTTHUMP00000164349; OTTHUMP00000164350; OTTHUMP00000164351; OTTHUMP00000164352
Target Background
The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Several transcript variants encoding two different isoforms have been found for this gene.
Notification