Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRSF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GRSF1 (Q12849) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against GRSF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human GRSF1 (Q12849) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-13501A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRSF1 |
| Target Synonyms | GRSF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, 293T, Mouse brain, Mouse ovary, Rat kidney | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GRSF1 (Q12849). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLLLGAAAAAASQTRGLQTGPVPPGRLAGPPAVATSAAAAAAASYSALRASLLPQSLAAAAAVPTRSYSQESKTTYLEDLPPPPEYELAPSKLEEEVDDVF | Uniprot ID | Q12849 |
Uniprot Id
Q12849
Target Species
Human
Target Name
GRSF1
Target Full Name
G-rich sequence factor 1
Target Function
Regulator of post-transcriptional mitochondrial gene expression, required for assembly of the mitochondrial ribosome and for recruitment of mRNA and lncRNA. Binds RNAs containing the 14 base G-rich element. Preferentially binds RNAs transcribed from three contiguous genes on the light strand of mtDNA, the ND6 mRNA, and the long non-coding RNAs for MT-CYB and MT-ND5, each of which contains multiple consensus binding sequences. Involved in the degradosome-mediated decay of non-coding mitochondrial transcripts (MT-ncRNA) and tRNA-like molecules. Acts by unwinding G-quadruplex RNA structures in MT-ncRNA, thus facilitating their degradation by the degradosome. G-quadruplexes (G4) are non-canonical 4 stranded structures formed by transcripts from the light strand of mtDNA
Target Subcellular Location
[Isoform 1]: Mitochondrion matrix.; [Isoform 2]: Cytoplasm.
Target Synonyms
G rich RNA sequence binding factor 1; G rich sequence binding factor 1; G-rich sequence factor 1; GRSF-1; GRSF1; GRSF1_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
