-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GSTO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSTO1 (NP_004823.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GSTO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSTO1 (NP_004823.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13889A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GSTO1 |
| Target Synonyms | P28; SPG-R; GSTO 1-1; GSTTLp28; HEL-S-21; GSTO1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Jurkat, LO2, Rat liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSTO1 (NP_004823.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGK | Uniprot ID | P78417 |
Uniprot Id
P78417
Target Species
Human
Target Name
GSTO1
Target Full Name
Glutathione S-transferase omega-1
Target Function
Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
GST superfamily, Omega family
Target Tissue Specificity
Ubiquitous. Highest expression in liver, pancreas, skeletal muscle, spleen, thymus, colon, blood leukocyte and heart. Lowest expression in brain, placenta and lung.
Target Synonyms
AA407097; AI194287; AU018802; DKFZp686H13163; EC 2.5.1.18; Glutathione S transferase omega 1; Glutathione S-transferase omega 1-1; Glutathione S-transferase omega; Glutathione S-transferase omega-1; Glutathione transferase omega 1; Glutathione-dependent dehydroascorbate reductase; Glutathione-S-transferase like ; Glutathione-S-transferase omega 1; GSTO 1-1; GSTO-1; GSTO1 1; Gsto1; GSTO1_HUMAN; GSTTLp28; GSTX; Gtsttl; MGC94845; MMA(V) reductase; Monomethylarsonic acid reductase; OTTHUMP00000020429 ; p28; S-(Phenacyl)glutathione reductase; SPG-R
Target Background
The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene.
Notification