-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HACE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HACE1 (NP_065822.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HACE1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HACE1 (NP_065822.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10686A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HACE1 |
| Target Synonyms | SPPRS; HACE1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse brain, Mouse lung, Mouse spleen, Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HACE1 (NP_065822.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCT | Uniprot ID | Q8IYU2 |
Uniprot Id
Q8IYU2
Target Species
Human
Target Name
HACE1
Target Full Name
E3 ubiquitin-protein ligase HACE1
Target Function
E3 ubiquitin-protein ligase involved in Golgi membrane fusion and regulation of small GTPases. Acts as a regulator of Golgi membrane dynamics during the cell cycle: recruited to Golgi membrane by Rab proteins and regulates postmitotic Golgi membrane fusion. Acts by mediating ubiquitination during mitotic Golgi disassembly, ubiquitination serving as a signal for Golgi reassembly later, after cell division. Specifically interacts with GTP-bound RAC1, mediating ubiquitination and subsequent degradation of active RAC1, thereby playing a role in host defense against pathogens. May also act as a transcription regulator via its interaction with RARB.
Target Involvement
Spastic paraplegia and psychomotor retardation with or without seizures (SPPRS)
Target Subcellular Location
Golgi apparatus, Golgi stack membrane. Cytoplasm. Endoplasmic reticulum. Note=A significant portion localizes to the endoplasmic reticulum. Targeted to Golgi membrane via its interaction with Rab proteins.
Target Tissue Specificity
Expressed in multiple tissues including heart, brain and kidney.
Target Synonyms
HACE1; KIAA1320E3 ubiquitin-protein ligase HACE1; EC 2.3.2.26; HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1; HECT-type E3 ubiquitin transferase HACE1
Target Background
This gene encodes a HECT domain and ankyrin repeat-containing ubiquitin ligase. The encoded protein is involved in specific tagging of target proteins, leading to their subcellular localization or proteasomal degradation. The protein is a potential tumor suppressor and is involved in the pathophysiology of several tumors, including Wilm's tumor.
Notification