-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HAND1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-215 of human HAND1 (NP_004812.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HAND1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-215 of human HAND1 (NP_004812.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10863A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HAND1 |
| Target Synonyms | Hxt; eHand; Thing1; bHLHa27; HAND1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, A-549, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 16-215 of human HAND1 (NP_004812.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ | Uniprot ID | O96004 |
Uniprot Id
O96004
Target Species
Human
Target Name
HAND1
Target Full Name
Heart- and neural crest derivatives-expressed protein 1
Target Function
Transcription factor that plays an essential role in both trophoblast giant cell differentiation and in cardiac morphogenesis. Binds the DNA sequence 5'-NRTCTG-3' (non-canonical E-box). Acts as a transcriptional repressor of SOX15. In the adult, could be required for ongoing expression of cardiac-specific genes.
Target Subcellular Location
Nucleus, nucleoplasm. Nucleus, nucleolus.
Target Tissue Specificity
Heart.
Target Synonyms
autonomic nervous system and neural crest derivatives-expressed protein 1; Basic helix loop helix transcription factor HAND1; bHLHa27; Class A basic helix-loop-helix protein 27; eHAND; Extraembryonic tissues; Extraembryonic tissues heart autonomic nervous system and neural crest derivatives expressed protein 1; HAND 1; HAND1; HAND1_HUMAN; Heart and neural crest derivatives expressed 1; Heart and neural crest derivatives expressed protein 1; heart; Heart- and neural crest derivatives-expressed protein 1; Hxt; Thing 1; Thing1 ; Thing1
Target Background
The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation.
Notification