Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HAVCR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-125 of human HAVCR1 (NP_036338.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HAVCR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-125 of human HAVCR1 (NP_036338.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12462A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HAVCR1 |
| Target Synonyms | TIM; KIM1; TIM1; CD365; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1; HAVCR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, Mouse spleen, PC-12, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-125 of human HAVCR1 (NP_036338.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIV | Uniprot ID | Q96D42 |
Uniprot Id
Q96D42
Target Species
Human
Target Name
HAVCR1
Target Full Name
Hepatitis A virus cellular receptor 1
Target Function
May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. May play a role in kidney injury and repair.; (Microbial infection) Acts as a receptor for Hepatitis A virus.; (Microbial infection) Acts as a receptor for Ebolavirus and Marburg virus by binding exposed phosphatidyl-serine at the surface of virion membrane. Serves as a dual receptor for Ebolavirus by also interacting with envelope glycoprotein GP.; (Microbial infection) Acts as a receptor for Dengue virus by binding exposed phosphatidyl-serine at the surface of virion membrane.; (Microbial infection) Acts as a receptor for Zika virus by binding to envelope protein E.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, TIM family
Target Tissue Specificity
Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses.
Target Research Area
Immunology
Target Synonyms
CD365; HAVCR 1 ; HAVCR; HAVcr-1; Havcr1; Hepatitis A virus cellular receptor 1; Kidney injury molecule 1; KIM 1; KIM-1; T cell immunoglobin domain and mucin domain protein 1; T cell immunoglobulin mucin family member 1; T cell immunoglobulin mucin receptor 1; T-cell immunoglobulin and mucin domain-containing protein 1; T-cell membrane protein 1; TIM; TIM-1; TIM1; TIMD 1; TIMD-1; TIMD1; TIMD1_HUMAN
Target Background
The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. The protein is a receptor for multiple other viruses, including Ebola virus, Marburg virus, Dengue virus, and Zika virus and is a possible entry factor for SARS-CoV-2 and other coronaviruses.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
