Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HBZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human HBZ (NP_005323.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HBZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human HBZ (NP_005323.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09409A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HBZ |
| Target Synonyms | HBAZ; HBZ1; HBZ-T1; HBZ | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human HBZ (NP_005323.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR | Uniprot ID | P02008 |
Uniprot Id
P02008
Target Species
Human
Target Name
HBZ
Target Full Name
Hemoglobin subunit zeta
Target Function
The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
Target Protein Families
Globin family
Target Tissue Specificity
Detected in fetal erythrocytes (at protein level).
Target Research Area
Cardiovascular
Target Synonyms
HBAZ; HBAZ_HUMAN; HBZ 2; HBZ; HBZ2; Hemoglobin subunit zeta; Hemoglobin zeta; Hemoglobin zeta chain; Zeta globin; Zeta-globin
Target Background
Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
