Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HDAC11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-347 of human HDAC11 (NP_079103.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HDAC11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-347 of human HDAC11 (NP_079103.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09532A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HDAC11 |
| Target Synonyms | HD11; HDAC11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, MCF7, Mouse spinal cord, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-347 of human HDAC11 (NP_079103.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLSISPAGIVKRDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP | Uniprot ID | Q96DB2 |
Uniprot Id
Q96DB2
Target Species
Human
Target Name
HDAC11
Target Full Name
Histone deacetylase 11
Target Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
Target Subcellular Location
Nucleus. Note=Predominantly nuclear.
Target Protein Families
Histone deacetylase family
Target Tissue Specificity
Weakly expressed in most tissues. Strongly expressed in brain, heart, skeletal muscle, kidney and testis.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
FLJ22237; HD 11; HD11; HDA11_HUMAN; HDAC 11; HDAC11; Histone deacetylase 11
Target Background
This gene encodes a class IV histone deacetylase. The encoded protein is localized to the nucleus and may be involved in regulating the expression of interleukin 10. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
