-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HER2/ErbB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human HER2/ErbB2 (NP_004439.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HER2/ErbB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human HER2/ErbB2 (NP_004439.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12534A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HER2/ErbB2 |
| Target Synonyms | NEU; NGL; HER2; TKR1; CD340; HER-2; VSCN2; MLN 19; MLN-19; c-ERB2; c-ERB-2; HER-2/neu; p185(erbB2); HER2/ErbB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, SK-BR-3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human HER2/ErbB2 (NP_004439.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV | Uniprot ID | P04626 |
Uniprot Id
P04626
Target Species
Human
Target Name
ERBB2
Target Full Name
Receptor tyrosine-protein kinase erbB-2
Target Function
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.; In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.
Target Involvement
Glioma (GLM); Ovarian cancer (OC); Lung cancer (LNCR); Gastric cancer (GASC)
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Early endosome. Cytoplasm, perinuclear region. Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.; [Isoform 3]: Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Target Tissue Specificity
Expressed in a variety of tumor tissues including primary breast tumors and tumors from small bowel, esophagus, kidney and mouth.
Target Research Area
Transcription
Target Synonyms
Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; C erb B2/neu protein; CD340; CD340 antigen; Cerb B2/neu protein; CerbB2; Erb b2 receptor tyrosine kinase 2; ErbB-2 proto-oncogene; ERBB2; ERBB2_HUMAN; HER 2; HER 2/NEU; HER2; Herstatin; Human epidermal growth factor receptor 2; Metastatic lymph node gene 19 protein; MLN 19; MLN19; NEU; NEU proto oncogene; Neuro/glioblastoma derived oncogene homolog; Neuroblastoma/glioblastoma derived oncogene homolog; NGL; p185erbB2; Proto-oncogene c-ErbB-2; Proto-oncogene Neu; Receptor tyrosine-protein kinase erbB-2; TKR1; Tyrosine kinase type cell surface receptor HER2; Tyrosine kinase-type cell surface receptor HER2; V erb b2 avian erythroblastic leukemia viral oncogene homolog 2 (neuro/glioblastoma derived oncogene homolog); V erb b2 avian erythroblastic leukemia viral oncogene homolog 2; V erb b2 avian erythroblastic leukemia viral oncoprotein 2; V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian); V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Target Background
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Notification