-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HEXIM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-359 of human HEXIM1 (NP_006451.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HEXIM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-359 of human HEXIM1 (NP_006451.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08619A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HEXIM1 |
| Target Synonyms | CLP1; EDG1; HIS1; MAQ1; HEXIM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293F | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-359 of human HEXIM1 (NP_006451.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDDHDQEEPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD | Uniprot ID | O94992 |
Uniprot Id
O94992
Target Species
Human
Target Name
HEXIM1
Target Full Name
Protein HEXIM1
Target Function
Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor. Core component of the 7SK RNP complex: in cooperation with 7SK snRNA sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation. May also regulate NF-kappa-B, ESR1, NR3C1 and CIITA-dependent transcriptional activity. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Binds alpha-importin and is mostly nuclear (PubMed:16362050).
Target Protein Families
HEXIM family
Target Tissue Specificity
Ubiquitously expressed with higher expression in placenta. HEXIM1 and HEXIM2 are differentially expressed. Expressed in endocrine tissues.
Target Synonyms
Cardiac lineage protein 1; CLP 1; CLP1; EDG 1; EDG1; Estrogen down-regulated gene 1 protein; FLJ13562; Hexamethylene bis acetamide inducible 1; Hexamethylene bis acetamide inducible protein; Hexamethylene bis acetamide inducible transcript 1; Hexamethylene bis-acetamide-inducible protein 1; HEXI1_HUMAN; HEXIM 1; Hexim1; HEXIM1 protein; HIS 1; HIS1; HMBA inducible ; MAQ 1; MAQ1; Menage a quatre 1; Menage a quatre protein 1; Protein HEXIM1
Target Background
Expression of this gene is induced by hexamethylene-bis-acetamide in vascular smooth muscle cells. This gene has no introns.
Notification