-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human HK1 (NP_000179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against HK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human HK1 (NP_000179.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-16972A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HK1 |
| Target Synonyms | HK; HKD; HKI; HXK1; NMSR; RP79; HMSNR; HK1-ta; HK1-tb; HK1-tc; NEDVIBA; hexokinase; K1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, 293T, MCF7, Mouse brain, Mouse testis, Rat testis, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human HK1 (NP_000179.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGY | Uniprot ID | P19367 |
Uniprot Id
P19367
Target Species
Human
Target Name
HK1
Target Full Name
Hexokinase-1
Target Function
Catalyzes the phosphorylation of various hexoses, such as D-glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6-phosphate, respectively). Does not phosphorylate N-acetyl-D-glucosamine. Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate. Involved in innate immunity and inflammation by acting as a pattern recognition receptor for bacterial peptidoglycan. When released in the cytosol, N-acetyl-D-glucosamine component of bacterial peptidoglycan inhibits the hexokinase activity of HK1 and causes its dissociation from mitochondrial outer membrane, thereby activating the NLRP3 inflammasome.
Target Involvement
Hexokinase deficiency (HK deficiency); Neuropathy, hereditary motor and sensory, Russe type (HMSNR); Retinitis pigmentosa 79 (RP79)
Target Subcellular Location
Mitochondrion outer membrane; Peripheral membrane protein. Cytoplasm, cytosol.
Target Protein Families
Hexokinase family
Target Tissue Specificity
Isoform 2: Erythrocyte specific (Ref.6). Isoform 3: Testis-specific. Isoform 4: Testis-specific.
Target Research Area
Metabolism
Target Synonyms
BB404130; Brain form hexokinase; dea; DrHXK1; EC 2.7.1.1; Glycolytic enzyme ; HEXOKIN; hexokinase I; Hexokinase PI; Hexokinase type I; Hexokinase; tumor isozyme; Hexokinase-1; Hexokinase-A; HK I; HK1; HK1 tb; HK1 tc; Hk1-s; HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1; HXK1_HUMAN; im:7148527; mHk1-s; wu:fc09d08; wu:fc16e02; wu:fc21e02; wu:fq14b11; zgc:55790; zgc:77618
Target Background
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.
Notification