-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMGN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human HMGN3 (NP_620058.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HMGN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human HMGN3 (NP_620058.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03168A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMGN3 |
| Target Synonyms | TRIP7; PNAS-24; PNAS-25; HMGN3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human HMGN3 (NP_620058.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN | Uniprot ID | Q15651 |
Uniprot Id
Q15651
Target Species
Human
Target Name
HMGN3
Target Full Name
High mobility group nucleosome-binding domain-containing protein 3
Target Function
Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function.
Target Subcellular Location
Nucleus.
Target Protein Families
HMGN family
Target Tissue Specificity
Expressed in kidney, lung, pancreas, testis, skeletal muscle, heart, thyroid gland, pituitary gland, prostate and uterus. Low expression in liver, spleen, placenta and ovaries.
Target Synonyms
DKFZp686E20226; FLJ42187; High mobility group nucleosomal binding domain 3; High mobility group nucleosome-binding domain-containing protein 3; HMGN3; HMGN3_HUMAN; OTTHUMP00000016772; OTTHUMP00000016773; PNAS 24; PNAS 25; PNAS24; PNAS25; Thyroid hormone receptor interacting protein 7; Thyroid receptor-interacting protein 7; TR-interacting protein 7; TRIP 7 ; TRIP-7; TRIP7
Target Background
The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1.
Notification