Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXA13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human HOXA13 (P31271) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXA13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human HOXA13 (P31271) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16147A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXA13 |
| Target Synonyms | HOX1; HOX1J; HOXA13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, Hep G2, Mouse liver, Mouse spleen, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HOXA13 (P31271). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKD | Uniprot ID | P31271 |
Uniprot Id
P31271
Target Species
Human
Target Name
HOXA13
Target Full Name
Homeobox protein Hox-A13
Target Function
Sequence-specific, AT-rich binding transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.; Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Involvement
Hand-foot-genital syndrome (HFG); Guttmacher syndrome (GUTTS)
Target Subcellular Location
Nucleus.
Target Protein Families
Abd-B homeobox family
Target Synonyms
Homeo box 1J; Homeo box A13; Homeobox 1J; Homeobox A13; Homeobox protein Hox A13; Homeobox protein Hox-1J; Homeobox protein Hox-A13; Homeobox protein HOXA13; Homeobox1J; HomeoboxA13; HOX 1; HOX 1J; Hox 1J protein; HOX A13; HOX1; HOX1J; HOXA 13; HOXA13; HXA13_HUMAN; Transcription factor HOXA13
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
