Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOXD10 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-150 of human HOXD10 (NP_002139.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HOXD10 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-150 of human HOXD10 (NP_002139.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse kidney, using HOXD10 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-16429A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOXD10 |
| Target Synonyms | HOX4; HOX4D; HOX4E; Hox-4.4; HOXD10 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 1-150 of human HOXD10 (NP_002139.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPG | Uniprot ID | P28358 |
Uniprot Id
P28358
Target Species
Human
Target Name
HOXD10
Target Full Name
Homeobox protein Hox-D10
Target Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Target Involvement
Vertical talus, congenital (CVT)
Target Subcellular Location
Nucleus.
Target Protein Families
Abd-B homeobox family
Target Tissue Specificity
Strongly expressed in the adult male and female urogenital tracts.
Target Synonyms
AI385591; AI874987; Homeo box 4D; Homeo box D10 ; Homeobox D10; Homeobox protein Hox-4D; Homeobox protein Hox-4E; Homeobox protein Hox-D10; Hox 4.4; Hox 4.5; Hox 4D ; Hox 4E ; Hox 5.3; HOX4D ; HOX4E; HOXD10; HXD10; HXD10_HUMAN; OTTMUSP00000017845; RP23-313J15.9
Target Background
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as "rocker-bottom foot" deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
