-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSD17B6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 178-317 of human HSD17B6 (NP_003716.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HSD17B6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 178-317 of human HSD17B6 (NP_003716.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05614A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSD17B6 |
| Target Synonyms | HSE; RODH; SDR9C6; HSD17B6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, DU145, LO2, MCF7, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 178-317 of human HSD17B6 (NP_003716.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV | Uniprot ID | O14756 |
Uniprot Id
O14756
Target Species
Human
Target Name
HSD17B6
Target Full Name
17-beta-hydroxysteroid dehydrogenase type 6
Target Function
NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3-alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro). Can convert androsterone to epi-androsterone. Androsterone is first oxidized to 5-alpha-androstane-3,17-dione and then reduced to epi-andosterone. Can act on both C-19 and C-21 3-alpha-hydroxysteroids.
Target Subcellular Location
Microsome membrane; Peripheral membrane protein; Lumenal side. Early endosome membrane; Peripheral membrane protein; Lumenal side.
Target Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Target Tissue Specificity
Detected in liver and prostate (at protein level). Detected in adult liver, lung, brain, placenta, prostate, adrenal gland, testis, mammary gland, spleen, spinal cord and uterus. Detected in caudate nucleus, and at lower levels in amygdala, corpus callosu
Target Synonyms
17-beta-HSD 6; 17-beta-HSD6; 17-beta-hydroxysteroid dehydrogenase type 6; 3 hydroxysteroid epimerase ; 3(alpha >beta) hydroxysteroid epimerase ; 3(alpha >beta) hydroxysteroid epimerasel; 3-alpha->,beta-HSE; 3-alpha->,beta-hydroxysteroid epimerase; H17B6_HUMAN; HSD17B6; HSE ; Hydroxysteroid (17 beta) dehydrogenase 6; Hydroxysteroid (17 beta) dehydrogenase 6 homolog (mouse); Hydroxysteroid 17 beta dehydrogenase 6; NAD+ dependent 3 alpha hydroxysteroid dehydrogenase 3 hydroxysteroid epimerase ; NAD+ dependent 3 alpha hydroxysteroid dehydrogenase; Oxidative 3 alpha hydroxysteroid dehydrogenase; Oxidative 3-alpha hydroxysteroid dehydrogenase; Oxidoreductase ; Retinol dehydrogenase; RODH ; SDR9C6; Short chain dehydrogenase/reductase family 9C, member 6
Target Background
The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family.
Notification