-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSP27/HSPB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-205 of human HSP27/HSPB1 (P04792) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HSP27/HSPB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-205 of human HSP27/HSPB1 (P04792) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16555A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSP27/HSPB1 |
| Target Synonyms | CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067; HEL-S-102; HSP27/HSPB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BxPC-3, Mouse liver, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-205 of human HSP27/HSPB1 (P04792). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK | Uniprot ID | P04792 |
Uniprot Id
P04792
Target Species
Human
Target Name
HSPB1
Target Full Name
Heat shock protein beta-1
Target Function
Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins.
Target Involvement
Charcot-Marie-Tooth disease 2F (CMT2F); Neuronopathy, distal hereditary motor, 2B (HMN2B)
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
Small heat shock protein (HSP20) family
Target Tissue Specificity
Detected in all tissues tested: skeletal muscle, heart, aorta, large intestine, small intestine, stomach, esophagus, bladder, adrenal gland, thyroid, pancreas, testis, adipose tissue, kidney, liver, spleen, cerebral cortex, blood serum and cerebrospinal f
Target Synonyms
Heat shock 27kDa protein; 28 kDa heat shock protein; CMT2F; DKFZp586P1322; epididymis secretory protein Li 102; Estrogen regulated 24 kDa protein; Estrogen-regulated 24 kDa protein; Heat shock 25kDa protein 1; Heat shock 27 kDa protein; Heat shock 27kD protein 1; Heat shock 27kDa protein 1; Heat shock 28kDa protein 1; Heat Shock Protein 27; Heat shock protein beta 1; Heat shock protein beta-1; heat shock protein family B (small) member 1; HEL-S-102; HMN2B; HS.76067; Hsp 25; HSP 27; Hsp 28; Hsp B1; Hsp25; HSP27; Hsp28; HspB1; HSPB1_HUMAN; SRP27; Stress responsive protein 27; Stress-responsive protein 27
Target Background
This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy.
Notification