-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HSPA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13980A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPA2 |
| Target Synonyms | HSP70-2; HSP70-3; HSPA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-431, Mouse brain, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 488-637 of human HSPA2 (P54652). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE | Uniprot ID | P54652 |
Uniprot Id
P54652
Target Species
Human
Target Name
HSPA2
Target Full Name
Heat shock-related 70 kDa protein 2
Target Function
Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. Plays a role in spermatogenesis. In association with SHCBP1L may participate in the maintenance of spindle integrity during meiosis in male germ cells.
Target Subcellular Location
Cytoplasm, cytoskeleton, spindle.
Target Protein Families
Heat shock protein 70 family
Target Synonyms
70kDa; Hcp70.2; Heat shock 70 kDa protein 2; Heat shock protein 2; Heat shock protein 70.2; Heat shock related 70 kDa protein 2; Heat shock-related 70 kDa protein 2; Heat-shock protein, 70-KD, 2; Heat-shock protein, 70-KD, 3; HSP70 2; HSP70 3; Hsp70-2; HSP70-3; HSP70.2; HSP70A2; HSP72; HSP72_HUMAN; HSPA2; Hspt70; Hst70; MGC58299; MGC7795; MGC93458; OTTHUMP00000180664 ; Testis-specific heat shock protein-related
Target Background
Enables disordered domain specific binding activity; enzyme binding activity; and unfolded protein binding activity. Involved in negative regulation of inclusion body assembly and protein refolding. Located in cytosol.
Notification