Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 680-840 of human HSPA4 (NP_002145.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HSPA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 680-840 of human HSPA4 (NP_002145.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07930A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPA4 |
| Target Synonyms | RY; APG-2; HSPH2; hsp70; hsp70RY; HEL-S-5a; HS24/P52; HSPA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 680-840 of human HSPA4 (NP_002145.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID | Uniprot ID | P34932 |
Uniprot Id
P34932
Target Species
Human
Target Name
HSPA4
Target Full Name
Heat shock 70 kDa protein 4
Target Subcellular Location
Cytoplasm.
Target Protein Families
Heat shock protein 70 family
Target Synonyms
APG 2; Epididymis secretory sperm binding protein Li 5a; Heat shock 70 kDa protein 4; Heat shock 70 related protein APG 2; Heat shock 70-related protein APG-2; Heat shock protein, 110 kDa; HEL S 5a; HS24/P52; hsp70; Hsp70 RY; hsp70RY; HSP74_HUMAN; HSPA4; HSPH2; MGC131852; RY
Target Background
Predicted to enable ATP binding activity. Involved in chaperone-mediated protein complex assembly and protein insertion into mitochondrial outer membrane. Located in cytosol and extracellular exosome. Implicated in Chagas disease. Biomarker of chronic obstructive pulmonary disease; rheumatoid arthritis; type 2 diabetes mellitus; and ulcerative colitis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
