Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPA4L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human HSPA4L (NP_055093.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HSPA4L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human HSPA4L (NP_055093.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06988A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPA4L |
| Target Synonyms | APG1; APG-1; HSPH3; Osp94; HSPA4L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, K-562, Mouse brain, Rat testis, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human HSPA4L (NP_055093.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY | Uniprot ID | O95757 |
Uniprot Id
O95757
Target Species
Human
Target Name
HSPA4L
Target Full Name
Heat shock 70 kDa protein 4L
Target Function
Possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Heat shock protein 70 family
Target Synonyms
HSPA4L; APG1; OSP94; Heat shock 70 kDa protein 4L; Heat shock 70-related protein APG-1; Osmotic stress protein 94
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
