Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HTR1D was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human HTR1D (NP_000855.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HTR1D was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human HTR1D (NP_000855.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04524A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HTR1D |
| Target Synonyms | HTRL; RDC4; HT1DA; 5-HT1D; HTR1DA; HTR1D | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse stomach, Mouse testis, Rat testis, SGC-7901, SH-SY5Y, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HTR1D (NP_000855.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAG | Uniprot ID | P28221 |
Uniprot Id
P28221
Target Species
Human
Target Name
HTR1D
Target Full Name
5-hydroxytryptamine receptor 1D
Target Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Detected in brain neocortex and caudate nucleus (at protein level).
Target Research Area
Others
Target Synonyms
HTR1D; HTR1DA; HTRL; 5-hydroxytryptamine receptor 1D; 5-HT-1D; 5-HT1D; Serotonin 1D alpha receptor; 5-HT-1D-alpha; Serotonin receptor 1D
Target Background
Enables G protein-coupled serotonin receptor activity. Involved in adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway and intestine smooth muscle contraction. Is integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
